Search

Need help? +1 (302) 609-8217 - ANABOLICS
Need help? +1 (302) 609-8217 - ANABOLICS

In Stock

Sermorelin (GRF 1-29 ) 5mg

$120.00

Sermorelin Acetate 5mg – High-Quality Research Peptide

Sermorelin Acetate, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: Sermorelin Acetate 5mg
  • Catalogue Number: UKSERM2
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3358.9 g/mol
  • Purity: ≥98%
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)
  • Form: Lyophilised Solid

Usage and Storage:

Sermorelin Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

Sermorelin Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Reviews

There are no reviews yet.

Write a review

Your email address will not be published. Required fields are marked *

Back to Top
Product has been added to your cart
Compare (0)